Recherchez dans la Communauté

Vous avez une question ?

Interrogez la communauté

internet & fixe protéger mes données et mon accès internet

mail reçu me demandant d'appeler le 09*************.....

meritneter
helper confirmé
helper confirmé
790  

mail reçu me demandant d'appeler le 09*************.....

bonjour à tous

mail reçu dans ma boite messagerie orange

bien sûr, poubelle direct, mais j'ai regardé un peu sur le net et trouvé ça https://www.doisjerepondre.fr/numero-de-telephone/09*********

donc question : comment l'expéditeur a t'il eu mon adresse mail qui est relativmeent confidentielle ?

cordialement

---------------------------

 

29/08/2019 Lecture d'un message - mail Orange
https://webmail1m.orange.fr/webmail/fr_FR/read.html?check=&IDMSG
de "Orange client" <*********@orange.fr>
à monservice@orange.fr
date 29/08/19 17:39
objet Orange - Infos📞: 09********** Vocal le 29/08/2019
Bonjour
Un message vous a été envoyé via messages directement depuis son mobile.
Ce message a été déposé par le 09*********.
Date :27-08-2019
Pour le consulter:→: Orange – MOBILE
L'identification est obligatoire . Orange est doté d'un dispositif de sécuriser sur l'internet.
Bien cordialement
L'équipe écoute client.
Le service clients Internet.
contenu du message

---------------------

X-MUNQ: 61e82808370130ee018a91f724af081e
X-MSK: Off
Return-Path: <*******@orange.fr>
Received: from mwinf5d64 (mwinf5c64 [])
by mwinb1403 with LMTPA;
Thu, 29 Aug 2019 17:39:00 +0200
X-Sieve: CMU Sieve 2.3
Received: from opme11oxm29aub.bagnolet.francetelecom.fr ([10.110.82.29])
by mwinf5d64 with ME
id v3ev2000E0dxWP6033evsq; Thu, 29 Aug 2019 17:38:59 +0200
X-ME-User-Auth: olivier.56@orange.fr
X-bcc: xxxmon adresse mail
X-me-spamcause: (20)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddrudeivddgkeejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffkpdfqfgfvnecuuegrihhlohhuthemucegtddtnecuogfthfevqddquegrugfkmhhpohhrthgrnhgtvgculddvtddmnecujfgurhepfffhrhfvkffugggtrfgkofhisehrtdgtsgertdejnecuhfhrohhmpefqrhgrnhhgvgcutghlihgvnhhtuceoohhlihhvihgvrhdrheeisehorhgrnhhgvgdrfhhrqeenucffohhmrghinheptgeghidrvghunecukfhppedutddruddutddrkedvrddvledpudeliedrudeliedrudelfedrvddvvdenucfrrghrrghmpehhvghlohepohhpmhgvudduohigmhdvlegruhgsrdgsrghgnhholhgvthdrfhhrrghntggvthgvlhgvtghomhdrfhhrpdhinhgvthepuddtrdduuddtrdekvddrvdelpdhmrghilhhfrhhomhepohhlihhvihgvrhdrheeisehorhgrnhhgvgdrfhhrpdhrtghpthhtoheprghlihgvshhjtghomhesfigrnhgrughoohdrfhhrnecuvehluhhsthgvrhfuihiivgeptd
X-me-spamlevel: not-spam
X-ME-bounce-domain: wanadoo.fr
X-ME-Helo: opme11oxm29aub.bagnolet.francetelecom.fr
X-ME-Auth: b2xpdmllci41NkBvcmFuZ2UuZnI=
X-ME-Date: Thu, 29 Aug 2019 17:38:59 +0200
X-ME-IP: 196.196.193.222
X-ME-Entity: ofr
Date: Thu, 29 Aug 2019 17:38:55 +0200 (CEST)
From: Orange client <******@orange.fr>
Reply-To: Orange client <**********@orange.fr>
To: monservice@orange.fr
Message-ID: <943079822.119652.1567093135730.JavaMail.open-xchange@opme11oxm29aub.bagnolet.francetelecom.fr>
Subject: =?UTF-8?Q?Orange_-_Infos=F0=9F=93=9E:_09_71_07_51_72_Vocal_le_29/08/2019?=
MIME-Version: 1.0
Content-Type: multipart/related;
boundary="----=_Part_119651_294438868.1567093135700"
X-Priority: 3
Importance: Medium
X-Mailer: Open-Xchange Mailer v7.6.3-Rev45
X-Originating-IP: 196.196.193.222
X-Originating-Client: open-xchange-appsuite

 

[EDIT @meritneter  : merci de ne pas laisser apparaitre de données personnelles en public]

 

3 RÉPONSES 3
PatriciaG
super star
super star
750  

Re: mail reçu me demandant d'appeler le 09*************.....

Bonjour,

 

De plein de façons possibles.

Ne fais-tu jamais d'achats sur Internet ?

Même si ton adresse est confidentielle, elle figure dans le carnet de tes contacts, et l'un a pu être piraté.

 

Sans compter les envois en masse au hasard.

 

Bref, les possibilités sont multiples.

@+ Patricia
papou22
#TopMembre
#TopMembre
725  

Re: mail reçu me demandant d'appeler le 09*************.....

Bonjour @meritneter ,

 

Il s'agit d'un vulgaire phishing (tentative d'arnaque par hameçonnage).

Il ne faut pas être grand clerc pour le savoir ! Rien qu'à voir une phrase comme "Orange est doté d'un dispositif de sécuriser sur l'internet" qui n'est même pas en bon français.

 

Tout le monde en reçoit mais tout le monde ne les mets pas sur un forum public avec des adresses mail en clair ! Et tu te demandes comment le pirate a pu avoir ton adresse mail ?!!!

 

La collecte d'adresses à arnaquer est le principe de base de tout escroc sur le web, et il profite du fait que la plupart des gens laissent leurs contacts sur le web au lieu de les protéger dans un logiciel de messagerie sur leur PC ou leur téléphone. Les moyens de s'en procurer ne manquent pas et ensuite, ces adresses se revendent sur le net entre escrocs.

 

A chacun de se méfier.

 

https://communaute.orange.fr/t5/forums/searchpage/tab/message?advanced=false&allow_punctuation=false...

Un problème bien décrit est déjà à moitié résolu

meritneter
helper confirmé
helper confirmé
703  

Re: mail reçu me demandant d'appeler le 09*************.....

Bonjour et merci de vos réponse

 

dans la copie que j'ai posté,je croyais bien l'avoir enlevé ......! cette adresse mail ne sert jamais pour des achats sur internet, en fait, elle ne sert pratiquement jamais........

Vous avez une question ?

Interrogez la communauté

Déjà 657016 membres inscrits 🧡

2325 personnes actuellement en ligne

Tous les membres en ligne