Recherchez dans la Communauté

Vous avez une question ?

Interrogez la communauté

internet & fixe mon mail Orange

Hacker

Madolyne
contributeur occasionnel
2 844  

Re: Hacker

Bonjour,

Surtout ne pas ouvrir LES PIÈCES JOINTENT , mettre en indésirable et ensuite à la corbeille !

lili132
contributeur
2 764  

Re: Hacker

J’ai reçu exactement le même mail hier j’ai changé 2 fois de mot de passe et cela continue
papou22
#TopMembre
#TopMembre
2 761  

Re: Hacker

Bonjour @lili132,

 

Changer un mot de passe de compte n'a jamais empêché un message d'arriver dedans !

Un problème bien décrit est déjà à moitié résolu

Jolafrite2
contributeur
2 675  

Re: Hacker

Salut,

 

J’en suis à mon 3ème mail.

D’abord intitulé « urgent », puis « urgent » et ce matin « alerte ».

Je n’ai jamais répondu, mis à la corbeille.

(ces e-mails proviennent de mon adresse à la lettre près...)

Savez-vous au bout de combien de temps ces abrutis laissent tomber ?

 

voici ce qui apparaît en cliquant « voir l’en tête complet » :


Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2004 with LMTPA;
Tue, 29 Jan 2019 10:47:55 +0100

X-Sieve: CMU Sieve 2.3

Received: from dict-assistance.fr ([86.249.235.228])
by mwinf5c22 with ME
id W9nt1z01n4wLsnJ019ntxX; Tue, 29 Jan 2019 10:47:54 +0100

X-bcc: mon adresse

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (15)(0000)gggruggvucftvghtrhhoucdtuddrgedtledrjedvgddtkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhho
uhhtmecugedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephfffofggvfhtufgtgffksehmkeerredvtdejnecuhfhrohhmpehphhgvvghlhhihphgvseifrg
hnrgguohhordhfrhenucfkphepkeeirddvgeelrddvfeehrddvvdeknecurfgrrhgrmhephhgvlhhopeguihgtthdqrghsshhishhtrghntggvrdhfrhdpihhnvghtpeek
iedrvdegledrvdefhedrvddvkedpmhgrihhlfhhrohhmpehphhgvvghlhhihphgvseifrghnrgguohhordhfrhdprhgtphhtthhopehphhgvvghlhhihphgvseifrghnrg
guohhordhfrhenucevlhhushhtvghrufhiiigvpedt

X-me-spamlevel: not-spam

X-ME-Helo: dict-assistance.fr

X-ME-IP: 86.249.235.228

X-ME-Entity: ofr

From: mon adresse

Date: Tue, 29 Jan 2019 10:47:52 +0100

X-Mailer: Microsoft Outlook 15.0

MIME-Version: 1.0

To: =?utf-8?Q?pheel?= <monadresse@wanadoo.fr>

Thread-Index: g6Ut26QVAifXHQsbp2V8dMcgVcvJ7DDo

Subject: =?iso-8859-1?Q?Alerte?=

Content-Type: multipart/mixed; boundary="-----------NextPartae00r56e2ei02bzsm3jaflgcd1"

Content-Transfer-Encoding: 8bit

Message-ID: <pb_55567728112-0fNU7U@dict-assistance.fr>

Content-Language: fr

 

PS : j’ai changé mon mdp, et il semble que je ne reçois plus de mail d’adresse tierce depuis ce matin. Par acquis de conscience, je me suis envoyé deux mails tests (depuis cette adresse et depuis ma pro) et ils sont pourtant bien arrivés...

 

Que dois-je faire ?

 

merci d’avance

 

2Fredegonde
contributeur confirmé
contributeur confirmé
2 666  

Re: Hacker

Bonjour,

En ce qui me concerne, il ne s'agit pas seulement de 3 courriers mais il semble qu'un virus a bien été installé dans l'ordinateur.

titou65
contributeur
2 637  

Re: Hacker

Bonjour à tous et toutes bien pour moi c calme l'ordi fonctionne nikel mail idem j'ais rien changer en mdp ni mail.

Comment faire pour éloigner c youyous de orange mail?? Comment faire pour alerter et faire barrage pour étre tranquile en ne changent rien au foctionnement habituelle?? En françe on na pas de pétrole mais on doit pouvoir avoir une idée pour se défendre!!

Allée bon appéti à tous et on surveille leur comportement........

 

       Crdlt jc.

 

 

ovoldo
contributeur occasionnel
2 565  

Re: Hacker

pareil pour moi aujourd'hui

la meme adresse email car lorsque je la mets en indesirable, je ne peu plus m'ecrire

Voila voila

Q5A4
contributeur
2 442  

Re: Hacker

Bonsoir,

idem ai reçu ce midi ce message de chantage pour prendre 520 € en Bitcoins et en contrepartie la non diffusion à mes contacts d'une soit disant vidéo faite de moi en train de visionner une vidéo à caractère pornographique.

Meme s'il m'est déjà arrivé d'en regarder une il y a quelques temps, je ne crois pas un traitre mot de ce message ignoble qui peut angoisser les plus fragiles psychologiquement, et qui pourraient malheureusement se soumettre à leurs exigences et se faire "plumer". Je suis habitué à recevoir des messages de tous genre dont beaucoup de sms ou mails de personnes connues demandant mon aide et les détruis aussi sec.

 N'hésitez pas à supprimer tout message louche sans ouvrir les pièces jointes, et surtout ne pas répondre.

 

 

 

collsyl
contributeur
2 300  

Re: Hacker

Je viens d'avoir un mail me demandant 520€ sinon des vidéos porno de moi seraient envoyer à tous mes amis? Que dois-je faire?

collsyl
contributeur
2 296  

Re: Hacker

J'ai reçu le même messagehacker2.jpghacker1.jpg

Vous avez une question ?

Interrogez la communauté

Déjà 751005 membres inscrits 🧡

1842 personnes actuellement en ligne

Tous les membres en ligne