Recherchez dans la Communauté

Vous avez une question ?

Interrogez la communauté

internet & fixe mon mail Orange

Les mails d'un site n'arrivent pas et quand ils arrivent, c'est avec 3 jours de retard

Gabriel83
contributeur
607  

Les mails d'un site n'arrivent pas et quand ils arrivent, c'est avec 3 jours de retard

Bonjour,

Je ne reçois plus les mails journaliers (news letter) de la Binck depuis déjà plusieurs mois et quand j'ai le bonheur d'en recevoir un, il arrive avec 3 jours de retard.

La Binck me dit que ce la vient d'orange.

Quelqu'un a -t-il rencontré ce problème?

Merci pour votre réponse

Bien cordialement

 

4 RÉPONSES 4
melet39
#TopMembre
#TopMembre
560  

Re: Les mails d'un site n'arrivent pas et quand ils arrivent, c'est avec 3 jours de retard

bonjour @Gabriel83 

 

à mon avis du fait que c'est un site étranger,cela vient du serveur de celui ci

 

cdt

"L'obstination est le chemin de la réussite." Charlie Chaplin
PhilDur
#TopMembre
#TopMembre
548  

Re: Les mails d'un site n'arrivent pas et quand ils arrivent, c'est avec 3 jours de retard

Bonjour @Gabriel83 

 

Tu ne peux pas dire "Je ne reçois plus les mails" et dans la même phrase "quand j'ai le bonheur d'en recevoir un".

On dira que tu ne les reçois pas tous ; c'est ce que j'ai cru comprendre.

 

Il faudrait vérifier le contenu des indésirables, tu ne dis pas si tu y es allé voir.

 

Pour tenter de te protéger d'un routage vers les indésirables, tu devrais commencer par ajouter l'adresse mail de l'expéditeur (à copier depuis un des rares mails reçus) dans ta liste verte.

 

"La Binck me dit que ce la vient d'orange."

A priori on ne peut que les croire, .... mais leur affirmation n'en fait pas une certitude.

 

 

Pour le délai, il n'y a rien à faire.

La messagerie ne prévoit rien en terme de délais d'acheminement.

Tu peux, peut être examiner l'en-tête détaillée d'un des messages reçu avec 3 jours de retard.

Dans l'en-tête tu trouve la trace horodatée, en ordre inverse et en anglais, de toutes les réceptions par tous les serveurs traversés.

 

Cordialement

PhilDur

 

 

 

Faites confiance aux produits libres : Firefox, Thunderbird, LibreOffice, Irfanview, VLC, 7-zip, FileZilla
Votre machine vous en remerciera
Gabriel83
contributeur
508  

Re: Les mails d'un site n'arrivent pas et quand ils arrivent, c'est avec 3 jours de retard

Bonjour Phildur

Je réponds un peu tardivement, mais mon smartphone refusait catégoriquement de se connecter.

- Réception de 1 mail sur 10, c'est pour cela que je dis que je ne reçois pas les mails journaliers de la Binck. Et comme je l'ai précisé, ce mail est arrivé sur ma messagerie avec 2 jours de retard.

- J'ai bien sûr examiné mes mails indésirables. Mais ils n'y sont pas, donc ils demeurent coincés quelque part.

Voici ce que je trouve dans l'en-tête d'un mail du 11 mars reçu le 14:

Return-Path: <from mwinf5c30 (mwinf5c30 [10.223.111.80])
by mwinb0504 with LMTPA;
Thu, 14 Mar 2019 05:50:49 +0100

X-Sieve: CMU Sieve 2.3

Received: from pmtafix.binckbank.nv (])
by mwinf5c30 with ME
id ngqo1z00V197eMu01gqooP; Thu, 14 Mar 2019 05:50:49 +0100

X-bcc: ******************@orange.fr

X-ME-bounce-domain: orange.fr

X-ME-engine: default

X-me-spamcause: (17)(0011)gggruggvucftvghtrhhoucdtuddrgedutddrhedugdejgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhho
uhhtmecugedttdenucdnofetkffnkffpifculddujedmnecujfgurhepkffhvffuffhrjfggtgesrgdtreertddtudenucfhrhhomhepfdeuihhntghkrdhfrhdfuceotg
hlihgvnhhtsegvmhgrihhlrdgsihhntghkrdhfrheqnecuffhomhgrihhnpeiiohhnvggsohhurhhsvgdrtghomhdpthifihhtthgvrhdrtghomhdplhhinhhkvgguihhn
rdgtohhmpdihohhuthhusggvrdgtohhmpdgsihhntghkrdhfrhdpfhgrtggvsghoohhkrdgtohhmnecukfhppeduleegrdehtddruddtvddrheefnecurfgrrhgrmhephh
gvlhhopehpmhhtrghfihigrdgsihhntghksggrnhhkrdhnvhdpihhnvghtpeduleegrdehtddruddtvddrheefpdhmrghilhhfrhhomheptghlihgvnhhtsegvmhgrihhl
rdgsihhntghkrdhfrhdprhgtphhtthhopehjrdgtlhgruhguvgdrtghhrghrrhhonhesohhrrghnghgvrdhfrhenucevlhhushhtvghrufhiiigvpedt

X-me-spamlevel: not-spam

X-ME-Helo: pmtafix.binckbank.nv

X-ME-IP:

X-ME-Entity: ofr

Received: from PAPPSEL01.binckbank.nv (unknown [10.120.128.4])
by pmtafix.binckbank.nv (Postfix) with SMTP id 891E83BB
for <*******************>; Mon, 11 Mar 2019 08:51:14 +0100 (CET)

Message-ID: <190311084907.SIM_YqrYtOqS%2Bro%2ByILzHl1vETPIgvbA1HodvSJwLtl%2BsGgVtGuI7qWQBa5ODB%2Bs5GMjzbBPkxqa7hHQL8gXY1hzKB0ikov6V@PAPPSEL
01.binckbank.nv>

From: "Binck.fr" <>

To: "Jc. CHARRON" <*******************>

Subject: La Matinale des Investisseurs du lundi 11 mars 2019

Date: Mon, 11 Mar 2019 08:49:07 +0100

Reply-To: =?iso-8859-1?B?U2VydmljZSBDbGllbnQg?= <clients@binck.fr>

List-Unsubscribe: <https/sim.binck.fr/optiext/optiextension.dll?ID=YqrYq9GQNs6gLZpNLZ%2B_QoJaxq7GQEFOJYi5GtYccxXDH_qc6T...
kUvLR3pogWFhvm%2BebNzQK>

X-MA-Reference: SIM_YqrYtOqS%2Bro%2ByILzHl1vETPIgvbA1HodvSJwLtl%2BsGgVtGuI7qWQBa5ODB%2Bs5GMjzbBPkxqa7hHQL8gXY1hzKB0ikov6V

X-MA-Instance: SIM_YqrYtOqS%2Bro%2ByILzHl1vETPIgvbA1HodvSJwLtl%2BsGgVtGuI7qWQBa5ODB%2Bs5GMjzbBPkxqa7hHQL8gXY1hzKB0ikov6V.ab5018bd3faa48ba12cdf638
26c47ad3

MIME-Version: 1.0

Content-Type: multipart/alternative;
boundary="----=_NexPart_000"

 

J'avoue que je ne sais pas interprété ce contenu.

Si tu peux m'aider?

Merci

 

Gabriel 83

 

[EDIT : merci de ne pas afficher de données personnelles]

 

papou22
#TopMembre
#TopMembre
503  

Re: Les mails d'un site n'arrivent pas et quand ils arrivent, c'est avec 3 jours de retard

Bonjour @Gabriel83 ,

 

Message déplacé temporairement pour modération car il contient des adresses mail en clair.

Un problème bien décrit est déjà à moitié résolu

Vous avez une question ?

Interrogez la communauté

Déjà 754643 membres inscrits 🧡

1692 personnes actuellement en ligne

Tous les membres en ligne