Recherchez dans la Communauté

Vous avez une question ?

Interrogez la communauté

internet & fixe mon mail Orange

Reception d'un mail

DeveloppeurVb
contributeur occasionnel
1 245  

Reception d'un mail

Bonjour,

Je viens de recevoir un mail bizarre.

Je n'ai rien demandé a orange, et le lien de ce mail me dirige sur une page ressemblant a orange.

Je soupçonne fraude ou autre.

 

Voici le contenu du mail en source:

 

Return-Path: <aghhe3@kharyonamssl.com>
Received: from mwinf5c20 (mwinf5c20 [10.223.111.70])
  by mwinb1204 with LMTPA;
  Wed, 14 Dec 2016 05:10:05 +0100
X-Sieve: CMU Sieve 2.3
Received: from EUR02-VE1-obe.outbound.protection.outlook.com ([104.47.6.225])
 by mwinf5c20 with ME
 id Kg9e1u00V4rJ8bs01g9tFV; Wed, 14 Dec 2016 05:10:04 +0100
X-bcc: ********@wanadoo.fr
X-ME-bounce-domain: wanadoo.fr
X-ME-engine: default
X-me-spamcause: (90)(0000)gggruggvucftvghtrhhoucdtuddrfeelfedrieehgdefiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucgouhhnughishgtlhhoshgvugculdegtddmnegotffhvedqqdeurgguigdqrfhrihhorhhithihucdlvddtmdenogfthfevqddqhfhrohhmqdfpohetthculdeftddmnecujfgurhepkfggpffhphfufffrofgtihesrgdtreerredtvgenucfhrhhomhephfgrtghtuhhrrghtihhonhcuqdcusdcugghothhrvgdqshgvrhhvihgtvgenucffohhmrghinhepghhoohhglhgvrdgtohhmrdhslhdpvghluhhllhgvrdgtohhmpdhgohhoghhlvgdrtghomhenucfkphepuddtgedrgeejrdeirddvvdehpdeguddrledvrddugedrvddvieenucfrrghrrghmpehhvghlohepgfgftfdtvddqggfguddqohgsvgdrohhuthgsohhunhgurdhprhhothgvtghtihhonhdrohhuthhlohhokhdrtghomhdpihhnvghtpedutdegrdegjedriedrvddvhedpmhgrihhlfhhrohhmpegrghhhhhgvfeeskhhhrghrhihonhgrmhhsshhlrdgtohhmpdhrtghpthhtohepvghvvghlhihnvgdrsghlohgthhesfigrnhgrughoohdrfhhr
X-me-spamlevel: not-spam
X-ME-Helo: EUR02-VE1-obe.outbound.protection.outlook.com
X-ME-IP: 104.47.6.225
X-ME-Entity: ofr
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zahya.onmicrosoft.com;
 s=selector1-zahya-onmicrosoft-com;
 h=Fromate:Subject:Message-ID:Content-Type:MIME-Version;
 bh=ZLYZTB1rnKCNL0N7wsP3CAahFh9PS8XXMGv4RxmaayQ=;
 b=TRqpupPGYGSQEITjG8ICUmjNiTtpxox2AI+9pnkzRarpway19KB6KHr9RJVqNguka8tHU2SxKOi4fjYshHOqd0TmYP9uZIHBCK9BY97F5okhnnuABpkCnnj+MX/MB6bKLS7dkOXDe1qYiDeRx5MZWigGN6oZFMrpKdvPU/p9wJ8=
Authentication-Results: spf=none (sender IP is )
 smtp.mailfrom=aghhe3@kharyonamssl.com;
Received: from [192.168.248.1] (41.92.14.226) by
 DB6PR0701MB2248.eurprd07.prod.outlook.com (10.168.58.149) with Microsoft SMTP
 Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384_P384) id
 15.1.771.4; Wed, 14 Dec 2016 04:08:59 +0000
Message-ID: <7Vgv68OSKdUkS1LNbCyJUEQBpAkVQN4FbejIjEcMnKl7@kharyonamssl.com>
MIME-Version: 1.0
Authentication-Results: 02A
Disposition-Notification-To: 000T0SMJ
From: Facturation - / Votre-service
To: Undisclosed-Recipients:;
Precedence: Bulk
Subject: Documents N : 129320/FR.
Date: Wed, 14 Dec 2016 05:09:45 +0100
X-Conf: protection.outlook.com
X-AID: spf=none (sender IP is )
X-UK: b049dd61ddb055336b64e13b9b1b426d
X-Priority: 3 EUR01-HE1-obe.outbound
X-Mailer: 1.0.1.1
X-CAID-X-Sieve: 0000A1  CMU Sieve 2.3
Content-Type: multipart/alternative;
 boundary="--=BOUNDARY_121459_BTOW_HMYU_FWNB_BDEF"
X-Originating-IP: [41.92.14.226]
X-ClientProxiedBy: VI1PR0801CA0061.eurprd08.prod.outlook.com (10.168.60.157)
 To DB6PR0701MB2248.eurprd07.prod.outlook.com (10.168.58.149)
X-MS-Office365-Filtering-Correlation-Id: 952c3563-a2cc-424c-172f-08d423d7087d
X-Microsoft-Antispam: UriScan:;BCL:0;PCL:0;RULEID22001);SRVRB6PR0701MB2248;
X-Microsoft-Exchange-Diagnostics: 1;DB6PR0701MB2248;3:geo5nJN+r7xh9Rm8FLDWyZaonTf5WPETiF08KvcyELJfWFb0FDe+0B0mzFfIuV4piLBgsAcG+fOXsJYCQisav3LJrqCrZp24xNIGFJUc+Njm7x/6bnPwNVK7DR0NUyqwLI48w2oxw2DdwS2OYwjuuO6LgbnQJfehC3PMQBxuqEFPr7e0UAbAUWrpAcRfnC4+aMBaViivkUW5Ewt4fXx0YKawfzdj5baw2nudjFaTySroXVo9fBZh2ktRFPR2SeCc4eSEN9QiJMuj95ajwd5PRg==;25:/DfFoqhMYc0j8k73jrrH5vjpqGXZK7qxtoZ3VNyDNRYRHcjHp90iYF5yXJ8tC3XvcMDcEpsL1H/NMe1cJMynJk74OiRa9S04tjUUlEAXmbSlFF30+LdXYVycwwpTtPI8wUQlDBwd9zeIgIQfgHcJbBVYrfz/AQpfeyD2mRO7Eo2SfHQGhQtYSolWC+pkVtS+jbIAaoJQN68g8zdhxDBLUFcsxLCdUiKiNL0fZRLAtIgDj7Dvk6RG+nrhrWR8P/AHWCr57YkKpm7F+gsAG2KX9hfLCYBxuce/KIN0ajoEouUfpacsQ/Zgw6Aa6tQswY45LIZBO6fzoH+xc6z1YFwHxbXIll+L8k1xejJ3cQEm1cpwWYS7BZu4u1uATQqcWIEME2u1z+T/PmfrW0/601hnIkla5Zg5uZ+TlWDNsW7pYhfLOqqJ3SLWHyXjTMBu8lLc99ImofunRRKV8Qi7B1+90Q==
X-Microsoft-Exchange-Diagnostics: 1;DB6PR0701MB2248;31:J4XzmS33OpQ2z0aFIfWMJnmtGl1AX7Vc9VEU5zew/c8u3jUhOXw9/moUkozkgWlVtWce6BYbQR9uXtwCI0eDDWhKsE/oyjRXzCo1yHsSx5YaIkXOuvdjLCQRqB9ilw+Dce0AOvXDvKC+SR38sjsO+CylCKKjxmC5yqNZcpDUKXgmtyV8qEq871teu8gGMzjWPTbxX+mfkWAzB8Wd/SmolnpMPW8FZUpok70HFI5tqJ2XFawfE9yuXHXaEeaQGdhcKtkTeK0It4wen15YG345Dw==
X-Microsoft-Antispam-PRVS: <DB6PR0701MB2248C3D476D307D28BFEF16EED9A0@DB6PR0701MB2248.eurprd07.prod.outlook.com>
X-Exchange-Antispam-Report-Test: UriScan73312121905874)(211936372134217)(274538324951326);
X-Exchange-Antispam-Report-CFA-Test: BCL:0;PCL:0;RULEID6040375)(601004)(2401047)(8121501046)(5005006)(3002001)(10201501046)(2001001)(6041248)(20161123564025)(20161123562025)(20161123560025)(2016111802025)(20161123555025)(6043046)(6072148);SRVRB6PR0701MB2248;BCL:0;PCL:0;RULEID:;SRVRB6PR0701MB2248;
X-Microsoft-Exchange-Diagnostics: 1;DB6PR0701MB2248;4:yxigoq+fa1W5gwaS0lctq52mQ0ysxcEXquBCRy8rBxCtKzwQbn8EHOGuL2/LYwsnrxrQ+cGXFxpCLgzRmjVTjdblUIWkzuA8aDlnCG6OSNBBjsnjX0h35/sw0pHKw9k/wlbHTT8pa3YdZzrW38y7VkqOX/+MT/ljKZXzqZtjl2U7W/aOjkMwc0Rfmd5NtnnU3xIqJCyz53a5WnfXJbcDJWFVpj5HBNurzktesecslvg/Ib1dIkOSweI69stdAA9lOrCsvu+8e/EOKTkdPIZ4zZwyitd+njHUazLZPD4/7KZ2uzEV98IWBb4OIMVAaw0ffyCgCQu5dYIxRisWxtffnjH17Kr+YTKpqDq1IiNgVCY9MpDCAzbQpSf9uTb3MuRYq/GG/ANhS7V9mAgVPe6eRZl/9C0VpxusJY/bUrlklvYzk2uNwXJ6vIE1hQiz2yjxf8kSgL56dsmudALq+4qCPtm4H2M1oSv79oD1SBz/yBS3cxrk+Wg3X/lf0kQnu+FSeKG5UsYtU8wuCFQteMVGPf8jtBUPkWzcbIwl9eLQ95R9TTXOrPTkhWFboZc5cwrnbbceQUmIYLm5r8dwdiD1RUKtkdPge0rizeVlpy1LWX/9+OCXd38/W0DMeiJwKL6OO+LkiODXYNkTpvFeb8bDR6vDtYlgK9T5D4T944kXIQf7MN7Zob52UKWegDsMXVWhd+HfZPDW+lcjBQ4pFBaKk9gaJcPkYAh0IDKHDsHMjfZ9KQuw0lHnUM/fYzIdN+fy
X-Forefront-PRVS: 01565FED4C
X-Forefront-Antispam-Report: SFV:SPM;SFS10009020)(4630300001)(6049001)(7916002)(39860400002)(39850400002)(39450400003)(39840400002)(39410400002)(199003)(189002)(54206008)(6666003)(97736004)(7736002)(42882006)(606005)(5005630100002)(46552002)(7906003)(5000100001)(66066001)(110136003)(2060700002)(2906002)(5001810100001)(50226002)(189998001)(3846002)(6116002)(450100001)(84326002)(881003)(109986004)(10916006)(107886002)(81156014)(81166006)(5660300001)(42186005)(77096006)(6486002)(101416001)(8676002)(92566002)(10646004)(90366009)(38730400001)(7276002)(31430400001)(36756003)(564344004)(7336002)(117156001)(50986999)(7406005)(68736007)(7366002)(7416002)(106356001)(105586002)(81686999)(50939005)(62146012);DIRUT;SFP:1501;SCL:5;SRVRB6PR0701MB2248;H:[192.168.248.1];FPR:;SPF:None;PTR:InfoNoRecords;A:1;MX:1;LANG:fr;
Received-SPF: None (protection.outlook.com: kharyonamssl.com does not
 designate permitted sender hosts)
X-Microsoft-Exchange-Diagnostics: =?us-ascii?Q?1;DB6PR0701MB2248;23:obUHH2oYvCWTD8vpWco6bs5OtCYd4HpPluxXGQX?=
 =?us-ascii?Q?s5uRaNzWIfZLM+rtoknToWBtqvzZnBZCV7ylCNkpgXP4kv4X2J7iO5u54U2e?=
 =?us-ascii?Q?vbHT7Gx1velBj1hBhhwtUCKEahRvXHYSr2BFJYeG4EqOcbFF/IfdiuwvGkID?=
 =?us-ascii?Q?MCwsjLyinp52UKO7mNyR3aBZP1BUOGs/BC6UZ4D8CvEtWsePuWvNZ7UsYwtT?=
 =?us-ascii?Q?Cxk5Rz98sQ0WVQNUrAaSacC3osY7e69Qq0JJcujibxwm6AogNmtacCLZ3k6t?=
 =?us-ascii?Q?8MGNb7jgNVIyztXEaNc7I06k6geJWRkHfDTU+iiN0b2b6EnyvfAFbRwVEtV8?=
 =?us-ascii?Q?+3PFHZtKCFAHjs15TkQc2Od/k7OTpIzl/gKfNgl22e4WwYxN74MkfIS6l3w4?=
 =?us-ascii?Q?BwHMqZLfQDq7oHrOOx7TkmAZ6UgkDoKlQ3Iwl8vm+5qsy+qmINCnUd4YSch0?=
 =?us-ascii?Q?guA3iPSnbz2Sez2tHWiCzfPY1qWQUH0r2X7DEaDPbnRLCYrxzv4eElXOPWZ6?=
 =?us-ascii?Q?F3tlCLy2Bw7iJcA61QBI5vvHaFk39rwYONovzB7rWI5uuG28AeH+RUJeMc8k?=
 =?us-ascii?Q?pT45gnep/SYwYgRtCiD3Iv9tD1Er2w6/mNcZnU7HSfB38B/b4MhhIibh9/mI?=
 =?us-ascii?Q?tjA2z4p45BjOoJOBCEA0sxj66+5+8Ktd23qCi1jIHUffO3J/Bxfsik7d2pxH?=
 =?us-ascii?Q?e9VuTsMh4fWTAEkIczSyIT+KZmHAFfLjIEq3xyNKpfrAh23nNnWBFEibFRt6?=
 =?us-ascii?Q?DRctEywKaIJ8uW4edXvy20a466eADOYvvhAqZsvNfF/q2ILeR1E4ExSdnX+K?=
 =?us-ascii?Q?yDONNwVLtsee/hnv1c/q4mDKSGtCtCO29dr3WzCVuhjN5LUGOybyG4bzIcjQ?=
 =?us-ascii?Q?vx2z3t4aWUPhAo/jm9fkjgcFaqBkdGeCOxXCb/Q21XKGkY07cFHSpATAPyZO?=
 =?us-ascii?Q?Ua12eDGYDdt3vy7+g+pgsu0/X1PAd6RLdGNZVzXCRx8Q1/mKtIMNIMHzM9Bq?=
 =?us-ascii?Q?TxABJQ4igtcsFUA0CzKpP1NDLujt0BSOQ8XSJmDhgc/tJeAeudsRza1eVQA9?=
 =?us-ascii?Q?VZ5ymsoIGmKYM8TN13isTpzZf5FaRYEwaVkG4wiE3DxYL8L2iRKS0KAB6+ux?=
 =?us-ascii?Q?PkKhQUWLgp9dTWXuZTFmv0csc9XhgiVPOfMmMEfYl3tpyAcoLqqCnVs5N+Kt?=
 =?us-ascii?Q?/inayOEligA/pB9M76g7kbAaZPrTLaIbY5sEFIO0Duo/DcFRwiBN1KgeSTnp?=
 =?us-ascii?Q?yW+IeqHIuLK0ngYibjKXMT9cH97veUVvUxjGeBkvLMLTdMKz7Z4Lhn4ItVyk?=
 =?us-ascii?Q?rKlzdRh9riT7SDWkw2d7ZccPyHOCarcypZNvMNqJKxlLGjZEggMLO90cg1Sh?=
 =?us-ascii?Q?2abx6v1VJhjGCJwsr+M7LwtdksYsIhHIaui1tBxi9NIRF6DCce53fvKpx82e?=
 =?us-ascii?Q?ydhClR1Tq4KywPeHY46I2/mV53L0kg4HFZtH4DKntZokWiZzpmimt/2kw3oV?=
 =?us-ascii?Q?nizgDLshFv6MDA9Ea/EAWFLHfmI/HO2ntYvAX50AYNDPJsu27Pqe9JI3KAZQ?=
 =?us-ascii?Q?tQRdK8RALvNI6nAhbeA=3D=3D?=
X-Microsoft-Exchange-Diagnostics: 1;DB6PR0701MB2248;6+AlLvPcyxmURTN+McOzkNx1tIHT913v2qZz3orWfWeAVClpbS0/sqkuFOWysslI1aHW6WuGmEx1UOsy0mm5j1QPX6A9p3AJoq/p6sG0FIUEA22pclwmmE4HkY3v0885b+zRpsBvwnWB3WSuj7XhFifG16FHi9vWsHcRmnAvv/NjE8DSho2QbQg4Ou8zjJTH/m9J4pon4SbhQphmcUDFb02gOxA78SZYOokoHMZ3Yhz5GHa1MZt0vI5qXrx/Xnrb/haD5SK5L9NFkI4VyPcG/4khbUYxTo01T3QegOrIYgJ7X0Z2BO5+PF8mPAow6JM6YjsP95y2AphEwjt/Ye94To4LkU9if1OKbKE391Ap2eQLIDweMXNhNlDbyo9EtLO2lsr8jf1FrFzMSF2BrgGhnXObzmNHYlZzF+A680/pt9MjiMrlTdna73o2q96i2Vcy;5:RGeZrbF7fd1cDZFHlGPGgvwCYw0NsM5KVIHdcxhdbRvUJIatcX433YmJ3hCwjUZOSlZCmAxFFmykwefhze7c2LZ0z3+ip6SZQHYyGpcVymT121K8LwDT/SAoMrGDMucVsYLb7L16lbjpCg98+Ou1pQ==;24:0ohSaN2Esz7jyj6X1RsGexfMDFYtoWjR019ERYJ4qAK8NNCaVtwsjoRxWe2lYt938hpzPQwOqsOxLkcL7PuDjQ==
SpamDiagnosticOutput: 1:22
X-Microsoft-Exchange-Diagnostics: 1;DB6PR0701MB2248;7:52CmFn3yoAsoVr6qCLml6LA6+5M5eqlzlO73YQ01f9n+HM5GNP+rR3wpgYhHky/RiTFryAUc7FMTVhg1ByhrLYiMNrO76rRysRgLpuD9sqGWLUy72WRHyE1GtsQQj7Q26LJLHcEyeC5uYmPY/6wf5I7J49nbgwDiEGmBJi/cbucmc5NEkE9sJ2LVjaHfG+V2kkL/GYbPJdS6eY1tIYYlD0cxk0d/JmcPuXKgyErGIRLiXyphqaS4a4M4o+4W0BucTyRvw3FKoq5rmKtdSwIRAKThD1IsyPcmkDezolRHqzUY/7DUn+TJRcoD3UdjWclsUtizQoHgyGYcabCzraEEhN1+F7mv549870WLfSozVwaB9ehX4aXxntWnkN+Tl5Ywr2/3g7kg8rIK350DfNYbTd/1yb/TNZKgECw7FvzebDbF46Epj5Os45lwINRAOFeJjnzyjHyeks9OY5LHowmEeQ==
X-OriginatorOrg: kharyonamssl.com
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 14 Dec 2016 04:08:59.5523
 (UTC)
X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted
X-MS-Exchange-Transport-CrossTenantHeadersStamped: DB6PR0701MB2248

 

[EDIT: Merci @DeveloppeurVb de ne pas afficher de données personnelles en public].

 

 

1 RÉPONSE 1
PhilDur
#TopMembre
#TopMembre
1 241  

Re : Reception d'un mail

Bonjour

C'est un phishing à traiter comme tel

Transferer à abuse@orange.fr  avec le copier/coller de l'en-tête détaillée comme tu viens de la montrer.

Ensuite tu supprimes.

 

As-tu noté l'émetteur et par où ça passe

Authentication-Results: spf=none (sender IP is ) smtp.mailfrom=aghhe3@kharyonamssl.com;

 

Orange n'utilise pas ce genre de chose.

Cordialement

PhilDur

Faites confiance aux produits libres : Firefox, Thunderbird, LibreOffice, Irfanview, VLC, 7-zip, FileZilla
Votre machine vous en remerciera

Vous avez une question ?

Interrogez la communauté

Déjà 755011 membres inscrits 🧡

1787 personnes actuellement en ligne

Tous les membres en ligne